PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009594207.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 349aa    MW: 38775.3 Da    PI: 6.0606
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009594207.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
   XP_009594207.1 14 KGPWTPEEDIILVSYIQQHGPGNWRAVPSNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.41e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   XP_009594207.1  67 RGNFTEHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.007965IPR017930Myb domain
SuperFamilySSF466891.08E-3011108IPR009057Homeodomain-like
SMARTSM007178.7E-151363IPR001005SANT/Myb domain
PfamPF002493.2E-161461IPR001005SANT/Myb domain
CDDcd001676.27E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.59466116IPR017930Myb domain
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002492.6E-1467112IPR001005SANT/Myb domain
CDDcd001671.74E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIILVSYIQ QHGPGNWRAV PSNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLRKKLKKLQ  120
GNDENSNQEG IRSSSQSNVS KGQWERRLQT DIHMAKKALC EALSLDKSDS PPNNPIPQPV  180
QSSCTYASSA ENISRLLQNW MKNSPKSSQF SQSNSECTTQ SSFNNLSIGQ GSSSSPSEGT  240
ISATTPEGFD PLFSFNSSNT DMLADESNAF TPENARIFQV ESKPDLPNLN AENGFLFQEE  300
SKPSLESEVP LTLLEKWLFD DAINAPAQEN LMGLGIGMGM TLGDASDLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-26141164105C-Myb DNA-Binding Domain
1msf_C2e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755152e-87HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594207.10.0PREDICTED: myb-related protein 306
RefseqXP_016450803.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-138MYB06_ANTMA; Myb-related protein 306
TrEMBLK4BLB20.0K4BLB2_SOLLC; Uncharacterized protein
STRINGSolyc03g116100.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-109myb domain protein 94